- CFAP74 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90921
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: LDVPVESLTA IPVFDPRHRE ASSRPGPLSP EAEELRPILV TLDYIQFDTD TPAPPATREL QVGCIRTTQP SPKK
- Human
- CFAP74
- 0.1 ml (also 25ul)
- Rabbit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- cilia and flagella associated protein 74
- C1orf222, CILD49, KIAA1751
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK
Specifications/Features
Available conjugates: Unconjugated